Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Inqoba-1, PC Federal Contracts

Correct this listing

Doing business as ML REED VALUATION

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary XRKWRJEP23K7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9HHG6· SALT LAKE CITY, UT· Active registration until Jan 10, 2027

Overview

Buyers and offices that award Inqoba-1, PC prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDepartmental Offices$160KIBC ACQ SVCS DIRECTORATE (00004)(140D04)$160K · Departmental Offices officeInqoba-1, PC$160K
Awards toSubcontracts toCircle area = dollars

Insight IBC ACQ SVCS DIRECTORATE (00004) (140D04) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2024–FY2026

$160K

Includes FY2026 so far: $38K, still being reported

About

From the company's SBA profile, updated Jan 2026

Mark L. Reed is a Certified General Appraiser in Utah, Idaho and New Mexico and holds the MAI designation from the Appraisal Institute. He first began appraising in 2004 and holds an MBA degree and a B.A. degree from Brigham Young University. His experience covers all real estate markets including land, ranches, residential and commercial properties. His primary focus is complex assignments and impaired real estate. His work often supports expert testimony and decisions made in eminent domain and condemnation proceedings, property tax disputes, real estate damages including fire-burned property, bankruptcy, estate planning matters, and cases involving breach of contract, among other things. His list of clients includes individuals, city, county, state, and federal government, financial institutions and mortgage companies, professional firms, and public and private corporations. He has performed a number of Yellow Book (UASFLA federal) appraisals over the past four years.

Prime contract obligations by fiscal year, US$, FY2024–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY24$122KFY26$38K so far

Insight Largest year: $122K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Utah$137K · 86%
  2. Idaho$23K · 14%
Circle area = dollarsOutlined: head office state (Utah)

Insight 86% was performed in Utah. See more on the Contracts tab