Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Intranet Communications Group, Inc.Report or remove this logo

Intranet Communications Group, Inc. Federal Contracts

Correct this listing

Doing business as ICG

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary N1YFMHQ2BD64· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 4LWZ4· BOCA RATON, FL· Active registration until Mar 24, 2027· www.icgconnects.com (opens in a new tab)

Overview

Buyers, this company and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsAir Force$13.6MU.S. Immigration andCustoms Enforcement$1.01MArmy$78.8K2 more$63KFA2823 AFTC PZIO$5.2M · Air Force officeFA6606 439 CONF PK$3.22M · Air Force officeFA9101 AEDC PKPPROCRMNT BR$1.88M · Air Force office10 more offices$4.46MIntranet CommunicationsGroup, Inc.$14.8MStran Technologies IT Services LLC$715KSunrise Network Solutions Inc.$409KConference Technologies, Inc.$123K
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 90% of what it reported subcontracting. See more on the Teaming tab

13 buying officesAll 3 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2007–FY2026

$18.8M

Includes FY2026 so far: $970K, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$1.25M

3 subcontractors

Subcontracts it received

$764K

from 3 primes

About

From the company's SBA profile, updated Mar 2026

Auto CAD Engineering Support, Telecommunications Fiber Installation, Communications Maintenance Hole Installation, Confined Space Safety Procedures, Base Telecommunications System Installation Services (BTIS), American National Standards Institute (ANSI), Copper Testing, Fiber Testing, Optical Time Domain Reflectometer (OTDR), As Built Documentation, Telecommunications Industry Association/Electronic Industry Association (TIA/EIA), Customer Premise Equipment, Building Distribution System, Protective Distribution Systems (PDS), Work Area Cabling, Secret Internet Protocol Router Network (SIPRNet), Building Riser Cable, Patch Panel, Main Distribution Frame (MDF), innerduct, Splice, Building Entrance Cables, Fiber Optic Patch Panel, Building Inside Structure Cabling (BISC), Telecommunications Rooms (TR), Telecom Pathways, Building Distribution Pedestal (BDP), Shielded Twisted Pair (STP) cabling, LAN cabling (Layer 1), NIPRNet (Unclassified) network, SIPRNet (Classified) network

Prime contract obligations by fiscal year, US$, FY2007–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY07FY09FY11FY14FY16FY18FY20FY22FY24$4.91MFY26FY26 so far: $970K

Insight Largest year: $4.91M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$14.8M since award = $14.4M in FY2021–FY2026 + $351K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Florida$6.51M · 44%
  2. Massachusetts$3.22M · 22%
  3. New Jersey$1.87M · 13%
  4. Tennessee$1.72M · 12%
  5. Louisiana$1.02M · 6.9%

2 smaller, $443K together.

Circle area = dollarsOutlined: head office state (Florida)

Insight 44% was performed in Florida. See more on the Contracts tab