Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Intuitive Information Systems Technologies LLCReport or remove this logo

Intuitive Information Systems Technologies LLC Federal Contracts

Correct this listing

Doing business as CHAINBRIDGE TECHNOLOGIES

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary NNHYHBK3HD45· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3JDU6· VIENNA, VA· Active registration until May 11, 2027· www.chainbridgetech.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyFederal EmergencyManagement Agency$79.8MEnergy$14.5MSmall BusinessAdministration$11.8M3 more$973KINFORMATION TECHNOLOGYCOMMODITIES ANDTELECOMMUNICATIONS (70FA30)$37.2M · Federal Emergency Managemen…INFORMATION TECHNOLOGYDEVELOPMENT AND SUSTAINMENT(70FA31)$28.5M · Federal Emergency Managemen…NNSA NON-MO CNTRCTNG OPS DIV(892331)$14.5M · Energy office6 more offices$27MIntuitive Information SystemsTechnologies LLC$107M
Awards toSubcontracts toCircle area = dollars

Insight INFORMATION TECHNOLOGY COMMODITIES AND TELECOMMUNICATIONS (70FA30) is its largest buyer. See more on the Buyers tab

9 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2003–FY2026

$135M

Includes FY2026 so far: $8.27M, still being reported

Subcontracts it received

$2.63M

from 3 primes

About

From the company's SBA profile, updated May 2026

Intuitive Information Systems Technologies is a small business providing custom software development services focusing on emergency preparedness and response systems. Our innovative use of cloud, mobile, GIS, and social media technologies, combined with policy and operational subject matter expertise, is applicable to the full spectrum of emergency response missions. Our Azure hosted web applications allow our clients the ability to effectively manage and monitor the deployment of of their response personnel to event sites with consideration to their availability, readiness level, training histories, and qualifications. Our software also allows Responders to take an active role in their qualifications and training history, by working with valid Coach Evaluators to progress in position task books, and registering for required training courses. Additionally, our staff maintains domain expertise in CBRNE as well as readiness, force structure management (ICS/NIMS), exercise planning.

Prime contract obligations by fiscal year, US$, FY2003–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY03FY08FY10FY12FY14FY16FY18FY20$19.1MFY22FY24FY26FY26 so far: $8.27M

Insight Largest year: $19.1M in FY2020; since FY2021, $15.8M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$107M since award = $60.7M in FY2021–FY2026 + $46.4M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$62.7M · 58%
  2. District of Columbia$44.5M · 42%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 58% was performed in Virginia. See more on the Contracts tab