Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Irepertoire Inc.Report or remove this logo

Irepertoire Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary GT35KNG2JGF4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 5EE39· HUNTSVILLE, AL· Active registration until May 15, 2027· www.irepertoire.com (opens in a new tab)

Overview

Buyers and offices that award Irepertoire prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Institutes ofHealth$157KVeterans Affairs$110KNETWORK CONTRACT OFFICE 23 (36C263)$110K · Veterans Affairs officeNATIONAL INSTITUTES OF HEALTH NIAID(75N930)$94.5K · National Institutes of Health of…NIH NCI (75N910)$58.3K · National Institutes of Health of…2 more offices$4,680Irepertoire Inc.$267K
Awards toSubcontracts toCircle area = dollars

Insight NETWORK CONTRACT OFFICE 23 (36C263) is its largest buyer. See more on the Buyers tab

5 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2013–FY2026

$686K

About

From the company's SBA profile, updated May 2026

iRepertoire, Inc., supplies products and services for the molecular analysis of the immune system using next-generation sequencing (NGS). These services include cell sorting, nucleic acid extraction, immune repertoire amplification, and NGS on Illumina systems. We also recently introduced single cell services for the pairing of receptor V(D)J rearrangements for human TCR alpha, beta, and immunoglobulin heavy and light chains. These technologies can be applied to a wide array of immune-based areas including autoimmunity, cancer research, and infectious disease. Our single cell technology is particularly applicable to immune-based drug development and can detect paired V(D)J rearrangements for rare populations of cells.

Prime contract obligations by fiscal year, US$, FY2013–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY13FY16FY17FY18FY19$153KFY20FY21FY22FY23FY24FY25$0

Insight Largest year: $153K in FY2019; since FY2021, $82.9K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$267K since award = $197K in FY2021–FY2026 + $69.6K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$243K · 91%
  2. Maryland$23.5K · 8.8%
Circle area = dollarsOutlined: head office state (Alabama)

Insight 91% was performed in Alabama. See more on the Contracts tab