Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Jaxon, Inc.Report or remove this logo

Jaxon, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary VS8HNK3FYTJ4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8FUW9· LINCOLN, MA· Active registration until Jun 1, 2027· jaxon.ai (opens in a new tab)

Overview

Buyers and offices that award Jaxon prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$4.84MNavy$4MNAVAIR WARFARE CTR AIRCRAFT DIV(N68335)$4M · Navy officeFA7014 AFDW PK$3.38M · Air Force officeFA8649 USAF SBIR STTR CNTRCTNGAFRL$850K · Air Force office1 more offices$610KJaxon, Inc.$8.84M
Awards toSubcontracts toCircle area = dollars

Insight NAVAIR WARFARE CTR AIRCRAFT DIV (N68335) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2020–FY2026

$8.89M

About

From the company's SBA profile, updated Jun 2026

Jaxon.AI is an AI verification agent that mathematically proves the output from AI models like ChatGPT is accurate. Based on R&D with DoD, Jaxon's proprietary DSAIL (Domain-Specific AI Logic) technology uses advanced reasoning techniques to check if AI-generated answers align with established policies, regulations, and known facts. Instead of modifying the AI itself, we treat it like a 'black box' and apply formal verification methods that follow strict rules and create a clear audit trail. As trust in AI remains a major challenge, Jaxon is making it reliable for mission-critical applications that require consistent, predictable results.

Prime contract obligations by fiscal year, US$, FY2020–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY20FY21FY22FY23FY24$4.73MFY25FY26$0 so far

Insight Largest year: $4.73M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Massachusetts$8.84M · 100%
Circle area = dollarsOutlined: head office state (Massachusetts)

Insight 100% was performed in Massachusetts. See more on the Contracts tab