Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
JCS Solutions LLCReport or remove this logo

JCS Solutions LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary KK2AW3NSF3U5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 79G93· FAIRFAX, VA· Active registration until Aug 24, 2027· jcssolutions.com (opens in a new tab)

Overview

Buyers, JCS Solutions and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsNational Institutes ofHealth$55.4MArmy$36.9MOffice of ProcurementOperations$28M7 more$15.3MNATIONAL INSTITUTES OFHEALTH NICHD (75N940)$45.2M · National Institu…W6QK ACC-RI (W519TC)$25.9M · Army officeCISA CONTRACTINGACTIVITY (70RCSJ)$22M · Office of Procure…11 more offices$42.5MJCS Solutions LLC$136MThe Mil Corporation$5.46MNative American Industrial SolutionsLLC$1.61MAmbit Group LLC$1.42MPeraton Inc.$361KOthsolutions, Incorporated$301KIntegrated Finance And AccountingSolutions, LLC.$244K2 more$130K
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 74% of what it reported subcontracting. See more on the Teaming tab

14 buying officesAll 8 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2016–FY2026

$149M

Includes FY2026 so far: $13.8M, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$9.53M

8 subcontractors

Subcontracts it received

$40.2M

from 7 primes

About

From the company's SBA profile, updated Aug 2026

JCS is a premier management consulting and IT firm offering enterprise-wide capabilities including information technology and software solutions, health IT, cyber security, program management, advanced analytics, cloud and enterprise solutions. JCS also provides services and support for our JCS Titan: Advanced Data Analytics and Real-Time Collaboration Platform that provides cross-domain analytics for finance, health, IT, cloud, cyber and more. JCS is an 8(a), EDWOSB, MOSB, and SD). JCS is appraised at CMMI Level 3 for Development and Services and ISO 9001:2015, ISO 20000-1:2011, and ISO 27001:2013 Certified. JCS maintain Top Secret facility clearance and DCAA approved accounting system. JCS offers products from the best hardware and software vendors in the industry. JCS is SWaM certified by the Commonwealth of Virginia. Our approach is customer first and mission always! We help our customers achieve sustainable and measurable results while mitigating risks.

Prime contract obligations by fiscal year, US$, FY2016–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY16FY17FY18FY19FY20FY21FY22FY23FY24$27.2MFY25FY26FY26 so far: $13.8M

Insight Largest year: $27.2M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$136M since award = $117M in FY2021–FY2026 + $18.9M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$67.5M · 50%
  2. Maryland$49.7M · 37%
  3. District of Columbia$18.5M · 14%
  4. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 50% was performed in Virginia. See more on the Contracts tab