Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Joint Tactics And Technologies, LLCReport or remove this logo

Joint Tactics And Technologies, LLC Federal Contracts

Correct this listing

Doing business as JOINT TACTICS AND TECHNOLOGIES

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary UPS2W9ZM5KT9· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 5VWA0· CORONADO, CA· Active registration until Aug 10, 2027· www.jtactech.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$53.7MMissile Defense Agency$500NAVAL INFORMATION WARFARESYSTEMS (N00039)$47.2M · Navy officeNIWC PACIFIC (N66001)$6.49M · Navy officeMISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency office1 more offices$0Joint Tactics And Technologies, LLC$53.7M
Awards toSubcontracts toCircle area = dollars

Insight NAVAL INFORMATION WARFARE SYSTEMS (N00039) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2010–FY2026

$59.3M

Includes FY2026 so far: $6.78M, still being reported

Subcontracts it received

$17.9M

from 9 primes

About

From the company's SBA profile, updated Aug 2026

Please see website www.jtactech.com Program Management, Systems Engineering, Solution Architect, system design and development, C&A, Cross Domain Solutions, Data Modeling, Test and Evaluation

Prime contract obligations by fiscal year, US$, FY2010–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY10FY15FY17FY18FY19FY20FY21FY22FY23FY24$12.8MFY25FY26FY26 so far: $6.78M

Insight Largest year: $12.8M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$53.7M since award = $50.8M in FY2021–FY2026 + $2.94M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$53.7M · 99%
  2. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (California)

Insight 99% was performed in California. See more on the Contracts tab