Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Jonah Ventures, LLCReport or remove this logo

Jonah Ventures, LLC Federal Contracts

Correct this listing

Doing business as JONAH VENTURES LLC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary UH7DCSGGJXQ7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6XQW1· BOULDER, CO· Active registration until Sep 15, 2027· jonahventures.com (opens in a new tab)

Overview

Buyers and offices that award Jonah Ventures prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Oceanic andAtmosphericAdministration$781KSmithsonian Institution$314KU.S. Geological Survey$92.2K3 more$116KDEPT OF COMMERCE NOAA (1305M3)$435K · National Oceanic and Atmospheri…DEPT OF COMMERCE NOAA (1333MJ)$273K · National Oceanic and Atmospheri…NATIONAL MUSEUM OF NATURALHISTORY (333152)$264K · Smithsonian Institution office8 more offices$332KJonah Ventures, LLC$1.3M
Awards toSubcontracts toCircle area = dollars

Insight DEPT OF COMMERCE NOAA (1305M3) is its largest buyer. See more on the Buyers tab

11 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2015–FY2026

$1.65M

Includes FY2026 so far: $144K, still being reported

Subcontracts it received

$45K

from 1 prime

About

From the company's SBA profile, updated Sep 2026

We have the capability to extract, amplify, and sequence DNA in a variety of samples using next generation sequencing. DNA can be analyzed to reconstruct animal diet, honey provenance, dust composition and origin.

Prime contract obligations by fiscal year, US$, FY2015–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY15FY16FY17FY18FY19FY20FY21FY22$289KFY23FY24FY25FY26FY26 so far: $144K

Insight Largest year: $289K in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$1.3M since award = $1.2M in FY2021–FY2026 + $98K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Colorado$783K · 60%
  2. Hawaii$336K · 26%
  3. Washington$63.8K · 4.9%
  4. District of Columbia$50.5K · 3.9%
  5. Wyoming$35K · 2.7%

3 smaller, $35.3K together.

Circle area = dollarsOutlined: head office state (Colorado)

Insight 60% was performed in Colorado. See more on the Contracts tab