Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Kaizen Approach Inc.Report or remove this logo

Kaizen Approach Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary F6NNKFH9EWQ5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 5SB32· COLUMBIA, MD· Active registration until Nov 5, 2026· www.kaizenapproach.com (opens in a new tab)

Overview

Buyers and offices that award Kaizen Approach prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyMissile Defense Agency$500Navy$500MISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeNSWC DAHLGREN (N00178)$500 · Navy officeKaizen Approach Inc.$1,000
Awards toSubcontracts toCircle area = dollars

Insight MISSILE DEFENSE AGENCY (MDA) (HQ0859) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$1,000

Includes FY2026 so far: $500, still being reported

About

From the company's SBA profile, updated Sep 2026

Kaizen Approach has contracts for Learning and Management Technologies Support, Instructional Systems Design, Workforce Development, Organizational Change Management, Training and Training Needs Assessment, Course Development, Intelligence Analyst Capabilities, Cybersecurity Services, Cross Domain Solutions, Security Architecture and Design, and is a CMMC RPO. Our experience with multiple prime contracts with the DoD, the Intelligence Community, Commercial Customers, the State of Maryland, and the NIH can bring a wealth of experience to any customer. We have an approved DCAA Accounting system, a Top-Secret Facility Clearance, and recently were re-awarded two of our prime contracts, both are five-year efforts supporting the DoD’s year National Cryptologic School. Our Financial Intelligence staff have been recognized for service in national crisis situations. We’re long-term partners with Fortune 500 companies, with one contract providing cyber technology support for 11 years.

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$500FY26$500 so far

Insight Largest year: $500 in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$500 · 50%
  2. Maryland$500 · 50%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 50% was performed in Alabama. See more on the Contracts tab