Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Keystone Mission Solutions Corp. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary LJDUYV4GUL65· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 99P12· KEYSTONE, CO· Active registration until May 22, 2027· keystone-ms.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$15.5MFA2518 USSF SPOC/SAIO$15.5M · Air Force officeKeystone Mission Solutions Corp.$15.5M
Awards toSubcontracts toCircle area = dollars

Insight FA2518 USSF SPOC/SAIO is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$15.5M

Includes FY2026 so far: $674K, still being reported

Subcontracts it received

$651K

from 1 prime

About

From the company's SBA profile, updated May 2026

Keystone Mission Solutions provides deep domain expertise in Space Superiority, Space Domain Awareness, and Satellite Command & Control Capabilities. We provide an exceptionally qualified team with a track record of success, rapidly delivering new weapon systems to the US Space Force and Intelligence Community. Keystone focuses on solution development and program programs in the early phase of their lifecycle to accelerate the delivery of new capabilities.

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$14.8MFY26$674K so far

Insight Largest year: $14.8M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Guam$15.5M · 100%
Circle area = dollarsOutlined: head office state (Colorado)

Insight 100% was performed in Guam. See more on the Contracts tab