Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Koda Technologies Inc.Report or remove this logo

Koda Technologies Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary YK6MYWL9B429· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7T7P5· HUNTSVILLE, AL· Active registration until Jul 30, 2027· www.kodatech.com (opens in a new tab)

Overview

Buyers and offices that award Koda Technologies prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyMissile Defense Agency$8.14MDefense InformationSystems Agency$2.34MAir Force$1.98M2 more$166KMISSILE DEFENSE AGENCY (MDA)(HQ0856)$7.99M · Missile Defense Agency officeIT CONTRACTING DIVISION - PL84(HC1084)$2.34M · Defense Information Systems…FA8750 AFRL RIK$1.98M · Air Force office5 more offices$317KKoda Technologies Inc.$12.6M
Awards toSubcontracts toCircle area = dollars

Insight MISSILE DEFENSE AGENCY (MDA) (HQ0856) is its largest buyer. See more on the Buyers tab

8 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2020–FY2026

$12.6M

Includes FY2026 so far: $2.25M, still being reported

Subcontracts it received

$72.2M

from 16 primes

About

From the company's SBA profile, updated Aug 2026

KODA Technologies is a WOSB headquartered in Huntsville, AL, delivering Advanced Engineering, R&D, and tech solutions in Radar, Seekers, M&S, Test and Evaluation, Hypersonics, Space Domain Awareness, Test Range Instrumentation, Interoperability, and Tactical Data Links. We hold OASIS+ & EWAAC IDIQs across domains. With deep expertise and mission focus, KODA leads high-impact defense efforts & has earned 6 consecutive Best Places to Work awards. https://www.kodatech.com/our-capabilities/

Prime contract obligations by fiscal year, US$, FY2020–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY20FY21FY22FY23FY24$3.92MFY25FY26$2.25M so far

Insight Largest year: $3.92M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$12.6M since award = $12.4M in FY2021–FY2026 + $241K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$10.3M · 81%
  2. Arizona$2.34M · 19%
  3. Florida$1,000 · 0.0%
Circle area = dollarsOutlined: head office state (Alabama)

Insight 81% was performed in Alabama. See more on the Contracts tab