Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Lawelawe Defense, Inc.Report or remove this logo

Lawelawe Defense, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary EY7ZKMMAA7D7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8V6C6· KAILUA, HI· Active registration until Feb 27, 2027· www.lawelawedefense.com (opens in a new tab)

Part of Native Hawaiian Organization Charity (opens another page) (parent company) · One of 4 registrations

Overview

Buyers, Lawelawe Defense and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsArmy$69.2MDefense Health Agency$68.6MAir Force$21.5M2 more$1,000DEFENSE HEALTHAGENCY (HT0014)$62.2M · Defense Health…W6QK ACC-RI (W519TC)$57.9M · Army officeFA7037 AMIC DET 2 JBSA$21.5M · Air Force office4 more offices$17.7MLawelawe Defense, Inc.$159MBowhead Cybersecurity Solutions &Services, LLC$15.6MBusiness Enabled Acquisition AndTechnology, Inc.$8.07MDiverse Systems Group, LLC$943K
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 96% of what it reported subcontracting. See more on the Teaming tab

7 buying officesAll 3 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2023–FY2026

$159M

Includes FY2026 so far: $28.3M, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$24.7M

3 subcontractors

About

From the company's SBA profile, updated Mar 2026

Lawelawe Defense Inc ('LDI') is an SBA Certified 8(a) Native Hawaiian Owned (NHO) SDB leveraging the capability and past performance of the Lawelawe portfolio of companies. LDI's capabilities include: • ISR Solutions: Mission-Critical Intelligence, leveraging multi-domain expertise for actionable intelligence and mission continuity. • Agile Program Management: Providing leadership and governance to ensure on-time and on-budget delivery of complex federal initiatives. • Data-Driven Innovation: Developing secure applications, advanced analytics, and modernization solutions for federal systems. • Cybersecurity Resilience: Enhancing cybersecurity with AI-driven analytics and robust system protection. • Human Capital Solutions: Empowering workforce transformation through tailored HR strategies and innovative tools. • Transformative IT and Healthcare Support: Delivering IT operations and clinical informatics to support mission-critical environments. • Proprietary Methodologies:

Prime contract obligations by fiscal year, US$, FY2023–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY23FY24FY25$76.3MFY26$28.3M so far

Insight Largest year: $76.3M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Kentucky$57.9M · 36%
  2. Maryland$57.7M · 36%
  3. Virginia$29.4M · 18%
  4. Hawaii$11.3M · 7.1%
  5. Texas$3M · 1.9%

1 smaller, $500 together.

Circle area = dollarsOutlined: head office state (Hawaii)

Insight 36% was performed in Kentucky. See more on the Contracts tab