Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Lexnan Ventures LLCReport or remove this logo

Lexnan Ventures LLC Federal Contracts

Correct this listing

Doing business as TRINAS CONCIERGE & CATERING

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary JUHBBCEQRJJ3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8PQ81· CONROE, TX· Active registration until Jan 5, 2027· www.trinacc.com (opens in a new tab)

Overview

Buyers and offices that award Lexnan Ventures prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$54.7KW7N2 USPFO ACTIVITY TX ARNG(W912L1)$54.7K · Army officeLexnan Ventures LLC$54.7K
Awards toSubcontracts toCircle area = dollars

Insight W7N2 USPFO ACTIVITY TX ARNG (W912L1) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$54.7K

Includes FY2026 so far: $54.7K, still being reported

About

From the company's SBA profile, updated Jan 2026

Lexnan Ventures LLC, DBA Trina’s Concierge and Catering (TCC) is a Texas-based company that brings decades of experience in the food delivery and catering domain. With a strong track record of serving over 100 corporate customers, TCC offers exceptional concierge and corporate food delivery services to clients throughout the state of Texas and has experience with serving all parts of the United States. TCC collaborates with local restaurants and caterers to provide personalized, high-quality food and catering solutions. As a Minority Owned Small Business with an SBA 8(a) certification, TCC is dedicated to leveraging the successful track record of serving corporate/ private companies and translating that success to provide the same high level service to State and Federal clients

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$54.7K so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Texas$54.7K · 100%
Circle area = dollarsOutlined: head office state (Texas)

Insight 100% was performed in Texas. See more on the Contracts tab