Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Lightspeed Technologies Inc.Report or remove this logo

Lightspeed Technologies Inc. Federal Contracts

Correct this listing

Doing business as LP3

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary LYN7MSHWX4E9· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3SYQ8· FAIRFAX, VA· Active registration until Jul 16, 2027· LP3.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$500NSWC DAHLGREN (N00178)$500 · Navy officeLightspeed Technologies Inc.$500
Awards toSubcontracts toCircle area = dollars

Insight NSWC DAHLGREN (N00178) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2008–FY2026

$8,651

About

From the company's SBA profile, updated Jul 2026

Cyber Security, Artificial Intelligence (AI), Machine Learning (ML), Data Science, Systems Engineering, Integration, Enterprise Security Architecture, Enterprise Architecture, Information Assurance, Multilevel Security, Cross-Domain Security, Network Security, Host Security, Certification & Accreditation, Assessment and Authorization (A&A), NIST, Cloud Security, Insider Threat, Risk Management Framework (RMF), CMMC, Authority to Operate (ATO), Open Source Intelligence (OSINT), Intel Analysis, Asset Protection, Online Sentiment Analysis, Active Shooter Alert, Intellectual Property Protection, Online Reputation Management, and Digital Asset Protection.

Prime contract obligations by fiscal year, US$, FY2008–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY08$5,959FY09FY14FY19FY20FY24$0

Insight Largest year: $5,959 in FY2008; since FY2021, $0 in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$500 since award = $0 in FY2021–FY2026 + $500 before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$500 · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Virginia. See more on the Contracts tab