Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Lotususa, Inc.Report or remove this logo

Lotususa, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary JBKGG25MLPM9· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 771V6· LOS ANGELES, CA· Active registration until Jul 16, 2027· www.lotususainc.com (opens in a new tab)

Overview

Buyers and offices that award Lotususa prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDefense Logistics Agency$4.33MArmy$4.19MAir Force$4.07M33 more$9.32MSSA OFC OF ACQUISITION GRANTS(283213)$1.12M · Social Security Administration…W6QM MICC-FT DRUM (W911S2)$928K · Army officeDLA LAND AND MARITIME (SPE7M1)$921K · Defense Logistics Agency office187 more offices$18.9MLotususa, Inc.$21.9M
Awards toSubcontracts toCircle area = dollars

Insight SSA OFC OF ACQUISITION GRANTS (283213) is its largest buyer. See more on the Buyers tab

190 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2015–FY2026

$30.7M

Includes FY2026 so far: $2.55M, still being reported

About

From the company's SBA profile, updated Jul 2026

LotusUSA, Inc is thriving and growing company with top work culture. Lotus USA, Inc. targets Federal Government agencies, state government, municipalities and Enterprise customers to support procurement equipment and in vast majority of fields, medical supplies and ongoing professional services. Lotus USA team develops lifecycle application projects and assume complete responsibility for analysis, design, implementation, testing, integration of systems and project deliverables. Networking. Professional Services, WIFI protocols Domain Epic health care Quality Assurance.NET Framework oracle java WebLogic, IBM Tivilo MQ Contract consulting databases SAP automation tools software defined Infrastructure development equipment.

Prime contract obligations by fiscal year, US$, FY2015–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY15FY16FY17FY18FY19FY20FY21FY22FY23FY24FY25$5.11MFY26FY26 so far: $2.55M

Insight Largest year: $5.11M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$21.9M since award = $23.8M in FY2021–FY2026 − $1.93M net corrections before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$13M · 59%
  2. North Carolina$800K · 3.6%
  3. Florida$758K · 3.5%
  4. Guam$670K · 3.1%
  5. Colorado$612K · 2.8%

39 smaller, $5.88M together.

No US state recorded: $196K · 0.9%

Circle area = dollarsOutlined: head office state (California)

Insight 60% was performed in California. See more on the Contracts tab