Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Marine Engine Repair Co. Inc.Report or remove this logo

Marine Engine Repair Co. Inc. Federal Contracts

Correct this listing

Doing business as MARINE ENGINE REPAIR CO INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary GV9JASL5KEF3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 0K210· SEATTLE, WA· Active registration until Jan 16, 2027· WWW.MEREQUIPMENT.COM (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$113KArmy$14.8KNational Oceanic andAtmospheric Administration$9,016NAVSUP FLT LOG CTR PUGET SOUND(N00406)$113K · Navy officeW074 ENDIST WILMINGTON (W912PM)$14.8K · Army officeDEPT OF COMMERCE NOAA (1333MF)$9,016 · National Oceanic and Atmospher…Marine Engine Repair Co. Inc.$137K
Awards toSubcontracts toCircle area = dollars

Insight NAVSUP FLT LOG CTR PUGET SOUND (N00406) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2004–FY2026

$363K

Includes FY2026 so far: $14.8K, still being reported

Subcontracts it received

$114K

from 1 prime

About

From the company's SBA profile, updated Jan 2026

Diesel engines for main propulsion, assemble custom diesel generators, distribute exhaust silencers and catalytic converters. Full line of marine and industrial generators for standby or prime power applications.

Prime contract obligations by fiscal year, US$, FY2004–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY04FY05FY06FY08FY10FY11FY15FY20FY21FY25$113KFY26FY26 so far: $14.8K

Insight Largest year: $113K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$137K since award = $129K in FY2021–FY2026 + $8,096 before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. North Carolina$14.8K · 11%
  2. Alaska$9,016 · 6.6%

No US state recorded: $113K · 83%

Circle area = dollarsOutlined: head office state (Washington)

Insight 62% was performed in North Carolina. See more on the Contracts tab