Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Materials & Technologies Corp.Report or remove this logo

Materials & Technologies Corp. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary X392VNKMSH54· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 0WDJ8· FISHKILL, NY· Active registration until Jun 30, 2027· WWW.MATECH.COM (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$2.52MNAVAIR WARFARE CTR AIRCRAFT DIV(N68335)$2.52M · Navy officeMaterials & Technologies Corp.$2.52M
Awards toSubcontracts toCircle area = dollars

Insight NAVAIR WARFARE CTR AIRCRAFT DIV (N68335) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2004–FY2026

$3.59M

About

From the company's SBA profile, updated Jul 2026

Materials and Technologies Corp. provides advanced process development and single sided cassette-to-cassette WaveEtch wet processing systems to thin, etch, develop, and rinse automatically a substrate?s single side. Thinning can be done down to 50 um.

Prime contract obligations by fiscal year, US$, FY2004–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY04FY05FY06FY17FY18FY19FY20FY21$979KFY22FY23$540K

Insight Largest year: $979K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$2.52M since award = $1.52M in FY2021–FY2026 + $997K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. New York$2.52M · 100%
Circle area = dollarsOutlined: head office state (New York)

Insight 100% was performed in New York. See more on the Contracts tab