Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Medequip Depot LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary MPFKJLPBU2Z4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6H2R8· DALLAS, TX· Active registration until Jun 29, 2027· www.medequipdepot.com (opens in a new tab)

Overview

Buyers and offices that award Medequip Depot prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDrug EnforcementAdministration$23.2KU.S. Coast Guard$16.2KState$11.8KSOUTHWEST LABORATORY (15DDL8)$23.2K · Drug Enforcement Administrati…TRACEN PETALUMA(00049) (70Z049)$16.2K · U.S. Coast Guard officeU.S. EMBASSY KABUL (19AF20)$11.8K · State officeMedequip Depot LLC$51.2K
Awards toSubcontracts toCircle area = dollars

Insight SOUTHWEST LABORATORY (15DDL8) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2013–FY2026

$80.5K

About

From the company's SBA profile, updated Jun 2026

Medequip Depot has been supplying Federal Agencies such as Veterans Affairs, Army, Navy, Air Force, FEMA, and the Federal Prison System for over a decade with PPE and Medical Equipment. We maintain U.S.-based stock ready to ship at a moment's notice such as N95 Masks, Nitrile Gloves, Isolation/Surgical Gowns, Face Shields, COVID-19 Testing & Antibody Kits, Disinfectant Spray/Wipes, Bouffants & Shoe Covers, Thermometers & more. View our profile for a full list of our past-performance.

Prime contract obligations by fiscal year, US$, FY2013–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY13FY15FY16FY21$35KFY22FY25−$163

Insight Largest year: $35K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Texas$35K · 68%
  2. California$16.2K · 32%
Circle area = dollarsOutlined: head office state (Texas)

Insight 68% was performed in Texas. See more on the Contracts tab