Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Mei Research, Ltd.Report or remove this logo

Mei Research, Ltd. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary MBKFB4TVN673· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 59P73· EDINA, MN· Active registration until Sep 23, 2027· meinergy.com (opens in a new tab)

Overview

Buyers and offices that award Mei Research prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Institutes ofHealth$662KAgricultural ResearchService$142KNATIONAL INSTITUTES OF HEALTH NICHD(75N940)$507K · National Institutes of Health off…NATIONAL INSTITUTES OF HEALTH OLAO(75N980)$155K · National Institutes of Health off…USDA ARS PA AAO ACQ/PER PROP(12805B)$142K · Agricultural Research Service o…Mei Research, Ltd.$804K
Awards toSubcontracts toCircle area = dollars

Insight NATIONAL INSTITUTES OF HEALTH NICHD (75N940) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2010–FY2026

$3.57M

Includes FY2026 so far: $186K, still being reported

About

From the company's SBA profile, updated Sep 2026

MEI Research has applied an understanding of health and behavior science to provide technology solutions for basic and clinical investigations since 2008. We are engineers who create software, sensors and algorithms for free-living environments, including ecological momentary assessments and intervention (EMA/EMI), energy expenditure and dietary intake, all within related social / environment context. MEI also designs, builds and renovates whole-body respiration calorimeters to measure minute by minute energy expended and substrate utilization. MEI supports entire research projects with study automation, data management and technical support services.

Prime contract obligations by fiscal year, US$, FY2010–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY10FY12$1.03MFY14FY16FY18FY20FY22FY24FY26$186K so far

Insight Largest year: $1.03M in FY2013; since FY2021, $253K in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$804K since award = $722K in FY2021–FY2026 + $82K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Minnesota$507K · 63%
  2. North Dakota$142K · 18%
  3. Maryland$80K · 10.0%
  4. Arizona$75.1K · 9.3%
Circle area = dollarsOutlined: head office state (Minnesota)

Insight 63% was performed in Minnesota. See more on the Contracts tab