Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Midbay Consulting LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary H5T2V8JMFFL5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 13VY7· BALTIMORE, MD· Active registration until Jun 13, 2027· www.midbayconsulting.com (opens in a new tab)

Overview

Buyers and offices that award Midbay Consulting prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyMissile Defense Agency$500MISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeMidbay Consulting LLC$500
Awards toSubcontracts toCircle area = dollars

Insight MISSILE DEFENSE AGENCY (MDA) (HQ0859) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$500

Includes FY2026 so far: $500, still being reported

About

From the company's SBA profile, updated Oct 2026

MidBay offers comprehensive consulting services tailored to the evolving needs of government agencies and healthcare systems. Our cross-functional team integrates domain expertise, modern technologies, and outcome-driven processes to deliver services across the following areas. - Healthcare Policy & Economy - Compliance & Audit - Medical Record Review - Data Analytics

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$500 so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$500 · 100%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 100% was performed in Alabama. See more on the Contracts tab