Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Modtech Solutions LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary DTJ4P9CE8TT8· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 64LQ8· AIEA, HI· Active registration until Jul 14, 2027· www.modtechhawaii.com (opens in a new tab)

Overview

Buyers and offices that award Modtech Solutions prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDefense InformationSystems Agency$4.94MArmy$3.86MNavy$3.01M3 more$4.85MDITCO-PAC (HC1019)$4.94M · Defense Information Systems…0413 AQ HQ RCO-HI (W912CN)$3.33M · Army officeDEPT OF COMMERCE NOAA (1305M4)$2.82M · National Oceanic and Atmosphe…13 more offices$5.56MModtech Solutions LLC$16.7M
Awards toSubcontracts toCircle area = dollars

Insight DITCO-PAC (HC1019) is its largest buyer. See more on the Buyers tab

16 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2010–FY2026

$25.4M

Includes FY2026 so far: $650K, still being reported

Subcontracts it received

$78.9M

from 12 primes

About

From the company's SBA profile, updated Sep 2026

Modtech is a Small, 8(a) certified, DBE certified, veteran and minority-owned business located in Honolulu, Hawaii. Modtech is managed by a highly qualified team with extensive government contracting, information technology (IT), audio-visual (AV) and telecommunications experience. Since its founding in 2008, Modtech has been a leader in IT/AV and telecommunications integration. Modtech specializes in multi-domain video teleconference (VTC) rooms, C4ISR facilities, conference rooms, classrooms, training facilities, digital signage and inside-plant telecommunications, and infrastructure wiring. Modtech has successfully performed over 400 contracted installations with the DoD and other entities. Modtech has a full staff of experienced and certified supervisors and technicians with active DoD security clearances.

Prime contract obligations by fiscal year, US$, FY2010–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY10FY13FY15FY17FY19FY21$7.79MFY23FY26$650K so far

Insight Largest year: $7.79M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$16.7M since award = $14.8M in FY2021–FY2026 + $1.89M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Hawaii$10.7M · 64%
  2. Maryland$3.26M · 20%
  3. Guam$353K · 2.1%
  4. Arizona$337K · 2.0%
  5. California$16.9K · 0.1%

1 smaller, $500 together.

No US state recorded: $2M · 12%

Circle area = dollarsOutlined: head office state (Hawaii)

Insight 73% was performed in Hawaii. See more on the Contracts tab