Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Moon Tiger LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary KE49X1M5S5J5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 91Y32· EL SEGUNDO, CA· Active registration until Apr 22, 2027· www.moontiger.com (opens in a new tab)

Overview

Buyers and offices that award Moon Tiger prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$500NSWC DAHLGREN (N00178)$500 · Navy officeMoon Tiger LLC$500
Awards toSubcontracts toCircle area = dollars

Insight NSWC DAHLGREN (N00178) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$500

Subcontracts it received

$3.45M

from 1 prime

About

From the company's SBA profile, updated Apr 2026

Moon Tiger is a software engineering and cyber security company bridging the gap between technical innovation and secure operations through disciplined practice of DevSecOps. Our unmatched expertise is highlighted by accelerated development of Space Domain Awareness applications and establishing foundational cyber capabilities for USSF space systems. With a remarkable track record of over 247 software iterations and securing ATOs for 4 environments, we not only ensure rapid compliance and production readiness but also demonstrate our profound commitment to advancing national space and cyber capabilities with secure, cutting-edge solutions.

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$500

Insight Largest year: $500 in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$500 · 100%
Circle area = dollarsOutlined: head office state (California)

Insight 100% was performed in California. See more on the Contracts tab