Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Nation Health LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary TDLSCBC3Y235· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8XT53· LAWTON, OK· Active registration until Dec 31, 2026

Overview

Buyers and offices that award Nation Health prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyIndian Health Service$1.44MNASHVILLE AREA INDIAN HEALTH SVC(75H715)$1.32M · Indian Health Service officePHOENIX AREA INDIAN HEALTH SVC(75H712)$115K · Indian Health Service officeNation Health LLC$1.44M
Awards toSubcontracts toCircle area = dollars

Insight NASHVILLE AREA INDIAN HEALTH SVC (75H715) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2021–FY2026

$1.44M

About

From the company's SBA profile, updated Jan 2026

Nation Health is a Native American-owned company that specializes in safety, security, and health assistance through our various products and services. We proudly specialize in serving commercial entities and agencies associated with Native American Nations. Our company started in 2020 to help protect and serve the Native American Nations and serve the public and private sectors. Our unique experience and expertise provide high-quality material/products and turn-key solution services. At Nation Health, it is our top priority to put our customers first by expressing respect, trust, and honor in every sector of our work. At Nation Health, our expertise includes the following: Telemedicine, Building Wellness, UV Lighting, Air Purification Systems and Monitoring, PPE Products, COVID Rapid Testing Kits, Covid Antigen, Antibody Testing Kits, and Laboratory Testing services.

Prime contract obligations by fiscal year, US$, FY2021–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY21$1.32MFY23FY25FY26$0 so far

Insight Largest year: $1.32M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Tennessee$1.32M · 92%
  2. California$115K · 8.0%
Circle area = dollarsOutlined: head office state (Oklahoma)

Insight 92% was performed in Tennessee. See more on the Contracts tab