Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Neuroscience Associates Inc.Report or remove this logo

Neuroscience Associates Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary NRS5DMZL6N75· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 06ND5· KNOXVILLE, TN· Active registration until Apr 27, 2027· www.NSALabs.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyVeterans Affairs$101KNational Institutes ofHealth$70.7KFood and DrugAdministration$61.8K1 more$59.7KFDA OFFICE OF ACQ GRANT SVCS(75F401)$61.8K · Food and Drug Administration o…262-NETWORK CONTRACT OFFICE 22(36C262)$60.4K · Veterans Affairs officeUSUHS (HU0001)$59.7K · Uniformed Services University…5 more offices$111KNeuroscience Associates Inc.$293K
Awards toSubcontracts toCircle area = dollars

Insight FDA OFFICE OF ACQ GRANT SVCS (75F401) is its largest buyer. See more on the Buyers tab

8 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2005–FY2026

$1.25M

Includes FY2026 so far: $59.7K, still being reported

About

From the company's SBA profile, updated Apr 2026

NSA is a full-service histology laboratory, providing all phases of histo services starting with proprietary MultiBrain Technology, along with digital imaging, analysis, antibody specialization, and CRO services.

Prime contract obligations by fiscal year, US$, FY2005–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY05FY07FY09FY11FY13FY15FY17$247KFY19FY21FY26$59.7K so far

Insight Largest year: $247K in FY2017; since FY2021, $186K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$293K since award = $134K in FY2021–FY2026 + $159K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Tennessee$133K · 45%
  2. Arizona$60.4K · 21%
  3. Maryland$59.7K · 20%
  4. Washington$30.7K · 10%
  5. New Jersey$9,760 · 3.3%
Circle area = dollarsOutlined: head office state (Tennessee)

Insight 45% was performed in Tennessee. See more on the Contracts tab