Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Nexagen Networks, Inc.Report or remove this logo

Nexagen Networks, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary UFZCFEVTJG77· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3EGC9· WALL TOWNSHIP, NJ· Active registration until May 11, 2027· www.nexagen.com (opens in a new tab)

Part of Nexagen Networks, Inc. (opens another page) (parent company) · The parent company's own registration, one of 2 · Company group: Nexagen Networks, Inc. (2 registrations)

Overview

Buyers and offices that award Nexagen Networks prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$116MNavy$39MDefense InformationSystems Agency$12M3 more$7.3MW6QK ACC-APG (W15P7T)$64.5M · Army officeNAVSUP FLT LOG CTR NORFOLK (N00189)$39M · Navy officeW6QK ACC-APG (W56JSR)$22.3M · Army office9 more offices$48.9MNexagen Networks, Inc.$175M
Awards toSubcontracts toCircle area = dollars

Insight W6QK ACC-APG (W15P7T) is its largest buyer. See more on the Buyers tab

12 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2008–FY2026

$227M

Includes FY2026 so far: $14.4M, still being reported

Subcontracts it received

$5.91M

from 5 primes

About

From the company's SBA profile, updated May 2026

Nexagen holds18+ Exceptional CPARS, 25+ Prime Contracts, 10+ Active IDIQs. Prime Contracts providing the following services: 1) MODERNIZATION AND DIGITIZATION: CLOUD COMPUTING AND DEVSECOPS. 2) SYSTEMS AND SOFTWARE ENGINEERING and Lifecycle Support. 3) COMMUNICATION: Wireless, SATCOM, SDN, NETOPS. 4) COMMAND and CONTROL(C2). 5) CYBERSECURITY: Zero Trust, ICAM, Security Engineering, RMF, FedRamp. 6) Network Operation Center (NOC) OPERATIONS, CONUS/OCONUS TRAINING/EXERCISE, Operation Support. The NOC supports multi-domain worldwide operations managing 1,800+ servers residing at the NOC, on Navy ships and in data centers of 35+ coalition partners. 7) Proof Of Concept Prototype Development using FACE. 8) LOGISTICS SUSTAINMENT SUPPORT.

Prime contract obligations by fiscal year, US$, FY2008–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY08FY10FY12FY14FY16FY18FY20FY22FY24$33.1MFY26FY26 so far: $14.4M

Insight Largest year: $33.1M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$175M since award = $125M in FY2021–FY2026 + $49.1M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. New Jersey$86.2M · 49%
  2. Virginia$51M · 29%
  3. Maryland$35.6M · 20%
  4. Tennessee$1.78M · 1.0%
  5. California$10K · 0.0%

2 smaller, $1,500 together.

Circle area = dollarsOutlined: head office state (New Jersey)

Insight 49% was performed in New Jersey. See more on the Contracts tab