Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Nimbis Services Inc.Report or remove this logo

Nimbis Services Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary HVBUF4XSR8K7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 53SC7· ORO VALLEY, AZ· Active registration until Sep 21, 2027· www.nimbisservices.com (opens in a new tab)

Overview

Buyers and offices that award Nimbis Services prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$75.8MFederal Acquisition Service$36.7MDefense ContractManagement Agency$27.9M2 more$4.5MFA8650 USAF AFMC AFRL PZLAFRL/PZL$75.8M · Air Force officeGSA FAS AAS REGION 5 (47QFLA)$36.7M · Federal Acquisition Service off…DCMA MOUNTAIN PACIFIC (S0302A)$27.5M · Defense Contract Management…5 more offices$4.92MNimbis Services Inc.$145M
Awards toSubcontracts toCircle area = dollars

Insight FA8650 USAF AFMC AFRL PZL AFRL/PZL is its largest buyer. See more on the Buyers tab

8 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2010–FY2026

$159M

Includes FY2026 so far: $500, still being reported

Subcontracts it received

$57.2K

from 1 prime

About

From the company's SBA profile, updated Sep 2026

Provides pre-negotiated access to high performance computing services, software, and expertise from the leading computer vendors, independent software vendors, and domain experts. Nimbis partners with the world’s leading computing services companies

Prime contract obligations by fiscal year, US$, FY2010–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY10FY12FY14FY16FY18$41.3MFY20FY22FY24FY26FY26 so far: $500

Insight Largest year: $41.3M in FY2019; since FY2021, $15.2M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$145M since award = $62.8M in FY2021–FY2026 + $82.1M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Arizona$80.2M · 55%
  2. Ohio$64.2M · 44%
  3. Virginia$522K · 0.4%
  4. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (Arizona)

Insight 55% was performed in Arizona. See more on the Contracts tab