Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Nira Inc.Report or remove this logo

Nira Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary VJRKWLBYYAD5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 78XX7· WASHINGTON, DC· Active registration until Aug 19, 2027· www.nira-inc.com (opens in a new tab)

Overview

Buyers and offices that award Nira prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyFederal AviationAdministration$18.2MConsumer Product SafetyCommission$16.1MFood and DrugAdministration$4.47M5 more$6.17MCONSUMER PRODUCT SAFETYCOMMISSION (613206)$16.1M · Consumer Product Safety Com…697DCK REGIONAL ACQUISITIONS SVCS$13.8M · Federal Aviation Administratio…FDA OFFICE OF ACQ GRANT SVCS(75F401)$4.47M · Food and Drug Administration o…6 more offices$10.6MNira Inc.$44.9M
Awards toSubcontracts toCircle area = dollars

Insight CONSUMER PRODUCT SAFETY COMMISSION (613206) is its largest buyer. See more on the Buyers tab

9 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2017–FY2026

$55.2M

Includes FY2026 so far: $2.94M, still being reported

Subcontracts it received

$31.8M

from 4 primes

About

From the company's SBA profile, updated Aug 2026

We Are Technology Experts - Providing technical expertise to federal and state governments best services: 1. Microsoft .Net Stack .Net Web Services SQL Server MSMQ 2. Business Process Management Suite Appian J2EE 3. Semantic Web We Understand Your Needs - In-Depth Domain Knowledge to Address Customer Challenges 1. Regulatory Workflow End-to-end workflow adaptable to regulation changes Case Management 2. Case Life Cycle Management Web Interfaces Human Interaction 3.Information Sharing Aviation Information Sharing among Agencies and International Partners We Work with Your Team - Agile Development Process with Customer Collaboration 1. Agile Process Short Sprints Daily Scrum Continuous Integration 2. Customer Focus Customer Part of the Team 3. Performance Metrics Key Performance Metrics Continuous Improvements

Prime contract obligations by fiscal year, US$, FY2017–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY17FY18FY19FY20FY21FY22$17.8MFY23FY24FY25FY26FY26 so far: $2.94M

Insight Largest year: $17.8M in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$44.9M since award = $43.9M in FY2021–FY2026 + $938K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. District of Columbia$30.4M · 68%
  2. Maryland$13.3M · 30%
  3. Virginia$1.18M · 2.6%
Circle area = dollarsOutlined: head office state (District of Columbia)

Insight 68% was performed in District of Columbia. See more on the Contracts tab