Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Nteligen, LLCReport or remove this logo

Nteligen, LLC Federal Contracts

Correct this listing

Doing business as NTELIGEN LLC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary NXNHJ15K41V4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 60D75· COLUMBIA, MD· Active registration until Jul 22, 2027· www.nteligen.com (opens in a new tab)

Overview

Buyers and offices that award Nteligen prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$100KMissile Defense Agency$500FA8750 AFRL RIK$98.7K · Air Force officeFA8612 AFLCMC C3BM C3$1,800 · Air Force officeMISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeNteligen, LLC$101K
Awards toSubcontracts toCircle area = dollars

Insight FA8750 AFRL RIK is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2017–FY2026

$951K

Includes FY2026 so far: $500, still being reported

Subcontracts it received

$19.3M

from 8 primes

About

From the company's SBA profile, updated Jul 2026

Nteligen develops data centric cybersecurity systems for cross-domain information flow, risk management in business workflows, and secure data distribution. Nteligen’s solutions are used to mitigate and eliminate zero-day attacks and to prevent data spillage in both high security Government communication and corporate enterprise environments. Nteligen specializes in the development of secure platform architectures that are designed to meet NIST 800-53, CNSS 1253, and NSA security guidelines, ensuring certification for use in classified networks. The company’s software provides secure and robust filter & pipeline orchestration, data processing, recursive deep-content inspection and sanitization, and secure data-flow. Applicable site and mission security policy are enforced while operating in environments that demand identification, authentication, authorization, and full audit and reporting capabilities.

Prime contract obligations by fiscal year, US$, FY2017–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY17$550KFY18FY20FY22FY23FY26$500 so far

Insight Largest year: $550K in FY2017; since FY2021, $1,800 in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$101K since award = $2,300 in FY2021–FY2026 + $98.7K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$100K · 99%
  2. Alabama$500 · 0.5%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 99% was performed in Maryland. See more on the Contracts tab