Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Ocean Power Technologies, Inc.Report or remove this logo

Ocean Power Technologies, Inc. federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary QMEHBTKWMQG3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 04EP7· Monroe Township, NJ· Active registration until Aug 14, 2027· www.oceanpowertechnologies.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$746KNIWC ATLANTIC (N65236)$365K · Navy officeNIWC PACIFIC (N66001)$231K · Navy officeNAVSUP FLT LOG CTR SAN DIEGO (N002…$150K · Navy officeOcean Power Technologies, Inc.$746K
Awards toOcean Power Technologies, Inc.ConnectedCircle area = dollars

Insight NIWC ATLANTIC (N65236) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2001–FY2026

$27.8M

Subcontracts it received

$1.23M

from 3 primes

About

From the company's SBA profile, updated Aug 2026

OPT specializes in the design and manufacturing of uncrewed surface vessels, offshore power systems, and advanced maritime data solutions that empower continuous, multi-domain situational awareness. Our flagship products, including the PowerBuoy® and WAM-V® USVs, deliver reliable power and communications for remote and distributed operations. Additionally, our Merrows™ platform offers AI-capable seamless integration of Maritime Domain Awareness Systems, ensuring the interoperability of defense technologies. OPT’s solutions enhance over the horizon operations, enabling smarter, faster, and more sustainable defense and surveillance missions in strategic maritime environments.

Prime contract obligations by fiscal year, US$, FY2001–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY01FY03FY05FY07FY09$5.47MFY11FY16FY18FY20FY24FY26No prime awards in FY2026 so far

Insight Largest year: $5.47M in FY2009; since FY2021, $365K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. South Carolina$365K · 49%
  2. California$231K · 31%
  3. New Jersey$150K · 20%
Circle area = dollarsOutlined: head office state (New Jersey)

Insight 49% was performed in South Carolina. See more on the Contracts tab