Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Oneida Environmental, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FKSYFWA3HXW4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9HCM5· MILWAUKEE, WI· Active registration until Feb 17, 2027

Part of Oneida Nation (opens another page) (parent company) · One of 25 registrations

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$57.6MBureau of Indian Affairs andBureau of Indian Education$2.62MAir Force$1.81M4 more$2.23MW071 ENDIST OMAHA (W9128F)$48.5M · Army officeW075 ENDIST ALBUQUERQUE (W912PP)$5.04M · Army officeWESTERN REGION (140A11)$2.62M · Bureau of Indian Affairs and Bu…11 more offices$8.12MOneida Environmental, LLC$64.3M
Awards toSubcontracts toCircle area = dollars

Insight W071 ENDIST OMAHA (W9128F) is its largest buyer. See more on the Buyers tab

14 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2023–FY2026

$64.3M

Includes FY2026 so far: $8.68M, still being reported

Subcontracts it received

$52.5K

from 1 prime

About

From the company's SBA profile, updated Aug 2026

Oneida Environmental (OE) is a Native American, tribally owned SBA certified 8(a), Small Disadvantaged Business. OE and affiliates perform the following services for Federal clients: •Natural/Cultural Resource Assessment and Management •CERCLA/RCRA (PA/SI, RI/FS, RFA/RFI, RD/RA, LTO/LTM, EBS), High-Resolution Site Characterization •PFAS Investigation and Remediation •Treatment system O&M and optimization •GIS Management, Remote Sensing •NEPA Documentation (EA, EIS, CATEX, FONSI) •Federal, State, Local government permitting (FDEP, USACE) •Construction monitoring, management, support •Mitigation & conservation banking •INRMP, ICRMP Preparation, Updates, Implementation •Munitions Response and Operational Range Clearance (LLRW, and Range Residue Removal, ESS development, UXO safety, MEC removal/disposal, MPPEH/MDAS certification, packaging, and recycling) •Installation-wide (Fence-to-Fence) regulatory compliance (CAA, CWA, SPCC, EPCRA, EMS, RCRA, TRI, NEPA, P2, INRMP, ICRMP)

Prime contract obligations by fiscal year, US$, FY2023–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY23FY24FY25$45.4MFY26$8.68M so far

Insight Largest year: $45.4M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Colorado$48.5M · 75%
  2. New Mexico$5.04M · 7.8%
  3. Wisconsin$2.64M · 4.1%
  4. Oklahoma$2.55M · 4.0%
  5. South Carolina$1.81M · 2.8%

5 smaller, $3.74M together.

Circle area = dollarsOutlined: head office state (Wisconsin)

Insight 75% was performed in Colorado. See more on the Contracts tab