Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Oneida Network Infrastructure, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FRLGMTTX3JR1· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8EZ37· ONEIDA, NY· Active registration until Feb 10, 2027· www.oneidainnovations.com (opens in a new tab)

Part of Oneida Indian Nation (opens another page) (parent company) · One of 4 registrations

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$1.57MEnvironmental ProtectionAgency$32.8KMissile Defense Agency$500FA2280 AFRL/RGKA$1.27M · Air Force officeFA2517 21 CONS BLDG 350$303K · Air Force officeOffice 68HERC$32.8K · Environmental Protection Agen…2 more offices$1,350Oneida Network Infrastructure, LLC$1.61M
Awards toSubcontracts toCircle area = dollars

Insight FA2280 AFRL/RGKA is its largest buyer. See more on the Buyers tab

5 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2022–FY2026

$1.61M

Includes FY2026 so far: $1.57M, still being reported

Subcontracts it received

$120K

from 1 prime

About

From the company's SBA profile, updated Feb 2026

Oneida Network Infrastructure, LLC (ONI) is an Integrated IT solutions provider with core competencies focused on computer system design, deployment, and support. Network Infrastructure is that portion of the IT services that allows devices to connect and communicate. Network infrastructure generally consists of hardware such as routers, switches, servers, firewalls, load balancers, cabling and wireless access points that provide services such as DNS (domain name services), IDS(intrusion detection services), key management, certificate authority, VoIP, and network management applications. We specialize in system architecture, system deployment and solution integration, wired and wireless network infrastructure, cybersecurity, intrusion detection and prevention, information assurance, risk management framework, and network management application support services. ONI delivers innovative solutions, rapid time-to-value and world-class service, training, and support.

Prime contract obligations by fiscal year, US$, FY2022–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY22FY25$32.8KFY26$1.57M so far

Insight Largest year: $32.8K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Ohio$1.27M · 79%
  2. Colorado$303K · 19%
  3. New York$33.7K · 2.1%
  4. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (New York)

Insight 79% was performed in Ohio. See more on the Contracts tab