Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Ortman Consulting LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary RT4EGJ94WGF5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 5QEF2· ALEXANDRIA, VA· Active registration until Jul 20, 2027· www.ortmanconsulting.com (opens in a new tab)

Overview

Buyers and offices that award Ortman Consulting prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$3.33MNavy$500FA8750 AFRL RIK$3.33M · Air Force officeFA8612 AFLCMC C3BM C3$3,423 · Air Force officeNSWC DAHLGREN (N00178)$500 · Navy officeOrtman Consulting LLC$3.33M
Awards toSubcontracts toCircle area = dollars

Insight FA8750 AFRL RIK is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2021–FY2026

$3.33M

Subcontracts it received

$49.9M

from 7 primes

About

From the company's SBA profile, updated Jul 2026

Ortman Consulting has over 15 years of experience as a system integrator and IT support provider for the Intelligence Community, Department of Defense and Department of Homeland Security. Our core competencies focus on secure endpoint computing and cross-domain services. We have pioneered the deployment of Commercial Solutions for Classified (CSfC) solutions and have deployed and managed secure desktop and secure virtual desktop solutions for government agencies worldwide. Services Include: • Cross-Domain User Desktops • Cross-Domain Transfer • Cross-Domain Voice/Video Applications • CSfC Campus Wireless • CSfC Mobility (Secure Telecommuting) • System Engineering and Administration • Network Engineering and Administration • Data Center Design/Upgrades • Virtual Desktop Infrastructure • Data-at-Rest Solutions and Software • System Accreditation/IA Support • Helpdesk • Amazon Web Services partner • Customer Relationship Management

Prime contract obligations by fiscal year, US$, FY2021–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY21FY23FY24$1.61MFY25$1.24M

Insight Largest year: $1.61M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$3.33M · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Virginia. See more on the Contracts tab