Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Pacific Defense Strategies Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary W93EQANE3JD5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7CSH5· NASHUA, NH· Active registration until Feb 24, 2027· www.pacific-defense.com (opens in a new tab)

Part of Pacific Defense Strategies, Inc. (opens another page) (parent company) · One of 3 registrations · Company group: Pacific Defense Strategies Inc. (3 registrations)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$1.54MW6QK ACC-APG (W56KGU)$1.1M · Army officeW6QK ACC-APG NATICK (W911QY)$441K · Army officePacific Defense Strategies Inc.$1.54M
Awards toSubcontracts toCircle area = dollars

Insight W6QK ACC-APG (W56KGU) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2017–FY2026

$2.58M

Subcontracts it received

$2.77M

from 5 primes

About

From the company's SBA profile

SPEAR RESEARCH is an engineering company focused on developing asymmetric technologies that tip the cost versus mission impact scales. By executing our research and development projects differently, we seek innovative solutions in cross-domain technologies and then blur the lines between the domains by leveraging the strengths of each. Our engineering specialties are multi-sensor system of systems architecture, electronic warfare systems, radar systems, algorithm development, signal processing and machine learning applications.

Prime contract obligations by fiscal year, US$, FY2017–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY17FY19FY20$1.17MFY21FY22FY23$0

Insight Largest year: $1.17M in FY2020; since FY2021, $814K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$1.54M since award = $814K in FY2021–FY2026 + $727K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. New Hampshire$1.54M · 100%
Circle area = dollarsOutlined: head office state (New Hampshire)

Insight 100% was performed in New Hampshire. See more on the Contracts tab