Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Pai Life Sciences Inc.Report or remove this logo

Pai Life Sciences Inc. Federal Contracts

Correct this listing

Doing business as PAI LIFE SCIENCES INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary MSMLUCM9DRT6· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 47SX4· SEATTLE, WA· Active registration until May 29, 2027· www.pailifesciences.com (opens in a new tab)

Overview

Buyers, Pai Life Sciences and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsNational Institutes ofHealth$3.24MNATIONAL INSTITUTES OFHEALTH NIAID (75N930)$3.24M · National Institu…Pai Life Sciences Inc.$3.24MNew York Blood Center, Inc.$529KThomas Jefferson University$443KDuke University$96.7K
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 91% of what it reported subcontracting. See more on the Teaming tab

1 buying officeAll 3 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2013–FY2026

$5.82M

Subcontracts it reported, on contracts active FY2021–FY2026

$1.07M

3 subcontractors

About

From the company's SBA profile, updated Jun 2026

PAI Life Sciences, Inc. is a Seattle, Washington-based biotechnology research and development company specializing in developmental and translational research that moves diagnostic, vaccine, and therapeutic products from laboratory discovery toward clinical and commercial applications. The company focuses on underserved disease areas and supports vaccine discovery, diagnostic discovery, process development, product prototyping, protein-based antigen development, adjuvant development, and small-molecule therapeutic research. PAI Life Sciences provides biotechnology R&D, translational development, vaccine research, protein purification, adjuvant development, immunotherapy, and diagnostic discovery support.

Prime contract obligations by fiscal year, US$, FY2013–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY13FY14FY15FY16FY17FY18FY19$3.26MFY20FY21FY22FY23FY24−$623K

Insight Largest year: $3.26M in FY2019; since FY2021, $598K in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$3.24M since award = −$25.1K in FY2021–FY2026 + $3.26M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Washington$3.24M · 100%
Circle area = dollarsOutlined: head office state (Washington)

Insight 100% was performed in Washington. See more on the Contracts tab