Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Paliton Networks LLC federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FHGNFLQDQ3V6· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 755P4· Leesburg, VA· Active registration until Feb 10, 2027· www.paliton.net (opens in a new tab)

Overview

Buyers and offices that award Paliton Networks prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyFederal AcquisitionService$168KDrug EnforcementAdministration$31.9KAir Force$30KOFFICE OF CENTRALIZED ACQUISITION…$168K · Federal Acquisition Service offi…FA3016 502 CONS CL$30K · Air Force officeLOS ANGELES CA DIVISION OFFICE (15D…$26.2K · Drug Enforcement Administrati…1 more offices$5,733Paliton Networks LLC$230K
Awards toPaliton Networks LLCConnectedGroupedCircle area = dollars

Insight OFFICE OF CENTRALIZED ACQUISITION SERVICES (47QACA) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2016–FY2026

$273K

Includes FY2026 so far: $27.3K, still being reported

About

From the company's SBA profile, updated Feb 2026

Paliton Networks is an SBA Small business founded by engineers. With a strong focus in providing network, cloud, cyber and managed services, Paliton strives to deliver expertise to all sectors from small business to public education to the Federal Government. Paliton has delivered Network Engineering design and support services for Mission Critical government infrastructures for over 20 years and has been frequently called upon to deliver solutions to complex engineering problems to address high profile mission requirements. Our vendor neutral and cross domain expertise in Network Design,Operations&Management,Cyber,Cloud and Physical Security have enabled our teams to work across organizational groups to optimize customer Networks, improve Security posture and increase Operational efficiencies. Paliton also provides fully Managed Wired/Wireless Network services to our customers.

Prime contract obligations by fiscal year, US$, FY2016–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY16FY18FY19FY22FY23FY24FY25$156KFY26$27.3K so far

Insight Largest year: $156K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. District of Columbia$168K · 73%
  2. Texas$30K · 13%
  3. Virginia$27.7K · 12%
  4. California$4,225 · 1.8%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 73% was performed in District of Columbia. See more on the Contracts tab