Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Pelican Residences LLCReport or remove this logo

Pelican Residences LLC Federal Contracts

Correct this listing

Doing business as PELICAN NATIONAL CONTRACTING

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary JMGAC5RAKQU9· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9CM85· DULUTH, GA· Active registration until Sep 10, 2027· www.pelican-contracting.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$1.61MArmy$1.03MFederal Prison System /Bureau of Prisons$625K5 more$541KBUILDING AND FACILITIES (FAO) (15BBNF)$625K · Federal Prison System / Bureau…W6QM MICC FT MCCOY (RC) (W911SA)$512K · Army officeFA4801 49 CONS PK$399K · Air Force office23 more offices$2.27MPelican Residences LLC$3.8M
Awards toSubcontracts toCircle area = dollars

Insight BUILDING AND FACILITIES (FAO) (15BBNF) is its largest buyer. See more on the Buyers tab

26 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2023–FY2026

$3.8M

Includes FY2026 so far: $962K, still being reported

About

From the company's SBA profile, updated Oct 2026

Pelican National Contracting is led by a Navy veteran of 26 years, the parent company was built on strong ethos of integrity, honesty and efficiency. Our 24x7 call center ensures that we are always available for our clients and we deliver on time. Pelican National Contracting is fully geared up to meet the demands of our government customers delivering quality workmanship and high standards. We have all the experience managing all aspects of buildings, offices, dwellings in the following field of heavy engineering, elevator maintenance/rebuild, Facilities support, flooring, HVAC and AC/heating systems, Plumbing, Electricals, play ground Differentiators • 24x7x365 operations • PMP certified Project Management Staff • Staff having domain knowledge in all facets of Facility Management • $4 Million Bonding capacity • 100% flawless execution of all contracts till date • Existing partnerships with large businesses • Large pool of trusted sub contractors

Prime contract obligations by fiscal year, US$, FY2023–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY23FY24$1.28MFY25FY26$962K so far

Insight Largest year: $1.28M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Colorado$625K · 16%
  2. Wisconsin$500K · 13%
  3. New Mexico$473K · 12%
  4. Texas$380K · 10.0%
  5. Louisiana$348K · 9.2%

21 smaller, $1.48M together.

Circle area = dollarsOutlined: head office state (Georgia)

Insight 16% was performed in Colorado. See more on the Contracts tab