Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Pragmatic Data LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary YTXLY9KSDHZ1· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 35PA8· INDIANAPOLIS, IN· Active registration until Jul 30, 2027· pragmaticdata.com (opens in a new tab)

Overview

Buyers and offices that award Pragmatic Data prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyFood and DrugAdministration$3.34MFDA OFFICE OF ACQ GRANT SVCS(75F401)$3.34M · Food and Drug Administration o…Pragmatic Data LLC$3.34M
Awards toSubcontracts toCircle area = dollars

Insight FDA OFFICE OF ACQ GRANT SVCS (75F401) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2007–FY2026

$12M

About

From the company's SBA profile, updated Aug 2026

We are an international leader in the field of biomedical information and knowledge design, standards, and their implementation for semantic interoperability of data from the biomedical domain, which includes scientific and business computing.

Prime contract obligations by fiscal year, US$, FY2007–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY07FY09FY11$1.36MFY13FY15FY17FY19FY21FY23FY25FY25: $504K

Insight Largest year: $1.36M in FY2011; since FY2021, $590K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$3.34M since award = $2.79M in FY2021–FY2026 + $545K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$2.37M · 71%
  2. Indiana$965K · 29%
Circle area = dollarsOutlined: head office state (Indiana)

Insight 71% was performed in Maryland. See more on the Contracts tab