Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Primer Federal Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary HLVJPF2S6WN5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8EVA5· ARLINGTON, VA· Active registration until Jul 30, 2027· primer.ai (opens in a new tab)

Part of Primer Technologies, Inc. (opens another page) (parent company) · One of 3 registrations

Overview

Buyers and offices that award Primer Federal prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$2.65MNavy$2.52MArmy$2.05MFA8649 USAF SBIR STTR CNTRCTNGAFRL$2.65M · Air Force officeNAVAIR WARFARE CTR AIRCRAFT DIV(N68335)$2.52M · Navy officeW27P USA ACQ SPT CTR (W51701)$2.05M · Army office1 more offices$1,800Primer Federal Inc.$7.22M
Awards toSubcontracts toCircle area = dollars

Insight FA8649 USAF SBIRSBIR: a federal program that funds small businesses to research and develop new technology, in phases, with a path to government sales. Glossary STTRSTTR: like SBIR, but the small business must team with a university or nonprofit research institution on the work. Glossary CNTRCTNG AFRL is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2022–FY2026

$7.22M

Subcontracts it received

$1.96M

from 2 primes

About

From the company's SBA profile, updated Aug 2026

Primer’s Artificial Intelligence and Machine Learning (AI/ML) technology empowers federal agencies to automate the analysis of massive unstructured datasets, saving thousands of hours of manual work and enabling analysts and decision makers to take action quickly based on reliable insights. Founded in 2015, Primer's industrial-grade Natural Language Processing (NLP) platform provides out-of-the-box and domain- specific models with human-level precision that may be trained to attain even greater levels of accuracy. Primer NLP is deployed by some of the world's largest government agencies, financial institutions, and Fortune 50 companies. Key Offering: Next-generation NLP Platform Primer’s open NLP platform provides its federal agency customers with extensive flexibility and customization. The core of its AI/ML technology uses proprietary Natural Language Understanding (NLU) and Natural Language Generation (NLG) algorithms. It is available in English, Arabic, and Mandarin.

Prime contract obligations by fiscal year, US$, FY2022–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY22FY23$2.94MFY24FY25$2.38M

Insight Largest year: $2.94M in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$7.22M · 99%
  2. California$1,800 · 0.0%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 99% was performed in Virginia. See more on the Contracts tab