Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Programs Management Analytics & Technologies Inc.Report or remove this logo

Programs Management Analytics & Technologies Inc. Federal Contracts

Correct this listing

Doing business as PMAT

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary DUQKMDGAMAK3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 4T2K3· NORFOLK, VA· Active registration until Jan 15, 2027· pmatinc.com (opens in a new tab)

Part of Programs Management Analytics & Technologies Inc. (opens another page) (parent company) · The parent company's own registration, one of 2 · Company group: Programs Management Analytics & Technologies Inc. (2 registrations)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$38.6MNAVAL INFORMATION WARFARESYSTEMS (N00039)$18.7M · Navy officeNAVAIR WARFARE CTR AIRCRAFT DIV(N68335)$16.5M · Navy officeOFFICE OF NAVAL RESEARCH (N00014)$2.15M · Navy office3 more offices$1.25MPrograms Management Analytics &Technologies Inc.$38.6M
Awards toSubcontracts toCircle area = dollars

Insight NAVAL INFORMATION WARFARE SYSTEMS (N00039) is its largest buyer. See more on the Buyers tab

6 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2008–FY2026

$58.8M

Includes FY2026 so far: $16M, still being reported

Subcontracts it received

$4.53M

from 10 primes

About

From the company's SBA profile, updated Jan 2026

Programs Management Analytics & Technologies, Inc. (PMAT) is a leading provider of Software Development, Systems Engineering, Data Science, Digital Engineering and Innovation, producing mission ready technical services and solutions to our clients. We support the U.S. Military, the Department of Defense, the Department of Homeland Security, the Intelligence Community, and other U.S. Government civil agencies. PMAT is focused on the concept of distributed operations and Command and Control (C2) Combat systems collaboration. Through cloud-based microservice applications, distributed data architecture, and machine learning, we are integrating tactical sensor data with national data in an intuitive way. Our solutions increase confidence in targeting, over-the-horizon, and overall multi-domain awareness.

Prime contract obligations by fiscal year, US$, FY2008–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY08FY11FY15FY17FY19FY21$17.2MFY26FY26 so far: $16M

Insight Largest year: $17.2M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$38.6M since award = $36.3M in FY2021–FY2026 + $2.29M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$19.9M · 52%
  2. California$18.7M · 48%
  3. Colorado$29.1K · 0.1%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 52% was performed in Virginia. See more on the Contracts tab