Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Programs Management Analytics & Technologies Inc.Report or remove this logo

Programs Management Analytics & Technologies Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary L94HLRR36MB5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 72WF1· SAN DIEGO, CA· Active registration until Jan 15, 2027· pmatinc.com (opens in a new tab)

Part of Programs Management Analytics & Technologies Inc. (opens another page) (parent company) · One of 2 registrations · Company group: Programs Management Analytics & Technologies Inc. (2 registrations)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$5.99MU.S. Special OperationsCommand$150KAir Force$76KNAVSEA HQ (N00024)$2.71M · Navy officeOFFICE OF NAVAL RESEARCH (N00014)$1.64M · Navy officeNAVAIR WARFARE CTR AIRCRAFT DIV(N68335)$1.62M · Navy office4 more offices$236KPrograms Management Analytics &Technologies Inc.$6.21M
Awards toSubcontracts toCircle area = dollars

Insight NAVSEA HQ (N00024) is its largest buyer. See more on the Buyers tab

7 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2017–FY2026

$6.34M

Includes FY2026 so far: $1.39M, still being reported

Subcontracts it received

$7.67M

from 2 primes

About

From the company's SBA profile, updated Jan 2026

Programs Management Analytics & Technologies, Inc. (PMAT) is a leading provider of Software Development, Systems Engineering, Data Science, Digital Engineering and Innovation, producing mission ready technical services and solutions to our clients. We support the U.S. Military, the Department of Defense, the Department of Homeland Security, the Intelligence Community, and other U.S. Government civil agencies. PMAT is focused on the concept of distributed operations and Command and Control (C2) Combat systems collaboration. Through cloud-based microservice applications, distributed data architecture, and machine learning, we are integrating tactical sensor data with national data in an intuitive way. Our solutions increase confidence in targeting, over-the-horizon, and overall multi-domain awareness.

Prime contract obligations by fiscal year, US$, FY2017–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY17FY21$2.18MFY22FY23FY24FY25FY26$1.39M so far

Insight Largest year: $2.18M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$5.13M · 83%
  2. Vermont$1.08M · 17%
  3. District of Columbia$1,000 · 0.0%
  4. Florida$1,000 · 0.0%
Circle area = dollarsOutlined: head office state (California)

Insight 83% was performed in California. See more on the Contracts tab