Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Protein Metrics, LLCReport or remove this logo

Protein Metrics, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary D3ZDKNNU9PT9· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 69TP1· BOSTON, MA· Active registration until Apr 21, 2027· proteinmetrics.com (opens in a new tab)

Part of Graphpad Software, LLC (opens another page) (parent company) · One of 6 registrations

Overview

Buyers and offices that award Protein Metrics prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyCenters for DiseaseControl and Prevention$219KNational Institutes ofHealth$108KNational Institute ofStandards and Technology$101KCDC OFFICE OF ACQUISITION SERVICES(75D301)$219K · Centers for Disease Control and…NATIONAL INSTITUTES OF HEALTH NIAID(75N930)$108K · National Institutes of Health off…DEPT OF COMMERCE NIST (1333ND)$101K · National Institute of Standards…Protein Metrics, LLC$428K
Awards toSubcontracts toCircle area = dollars

Insight CDC OFFICE OF ACQUISITION SERVICES (75D301) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2014–FY2026

$758K

Includes FY2026 so far: $90.1K, still being reported

Prime contract obligations by fiscal year, US$, FY2014–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY14FY15FY16FY17FY18FY19FY20FY21FY23FY24$148KFY25FY26$90.1K so far

Insight Largest year: $148K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Georgia$219K · 51%
  2. Maryland$115K · 27%
  3. California$94.3K · 22%
Circle area = dollarsOutlined: head office state (Massachusetts)

Insight 51% was performed in Georgia. See more on the Contracts tab