Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Protein Technologies Inc.Report or remove this logo

Protein Technologies Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary DZ63HNLZ2M19· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 38MC8· TUCSON, AZ· Active registration until Aug 3, 2027· www.gyrosproteintechnologies.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyFood and DrugAdministration$359KCenters for DiseaseControl and Prevention$108KNational Institutes ofHealth$39.7KFDA OFFICE OF ACQ GRANT SVCS(75F401)$359K · Food and Drug Administration of…CDC OFFICE OF ACQUISITION SERVICES(75D301)$108K · Centers for Disease Control and…NATIONAL INSTITUTES OF HEALTH NIAID(75N930)$31.6K · National Institutes of Health of…1 more offices$8,100Protein Technologies Inc.$507K
Awards toSubcontracts toCircle area = dollars

Insight FDA OFFICE OF ACQ GRANT SVCS (75F401) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2005–FY2026

$1.8M

Includes FY2026 so far: $1,229, still being reported

Prime contract obligations by fiscal year, US$, FY2005–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY05FY08FY10FY12$338KFY14FY16FY18FY20FY22FY24FY26FY26 so far: $1,229

Insight Largest year: $338K in FY2013; since FY2021, $161K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$507K since award = $232K in FY2021–FY2026 + $275K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Arizona$335K · 66%
  2. Maryland$94.2K · 19%
  3. Georgia$77.8K · 15%
Circle area = dollarsOutlined: head office state (Arizona)

Insight 66% was performed in Arizona. See more on the Contracts tab