Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Proteios Technology, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary G6QLLQD9UMT1· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7FC04· ISSAQUAH, WA· Active registration until Mar 22, 2027· www.proteios.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Institutes ofHealth$2.5MNIH NCI (75N910)$2.5M · National Institutes of Health off…Proteios Technology, Inc.$2.5M
Awards toSubcontracts toCircle area = dollars

Insight NIH NCI (75N910) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2021–FY2026

$2.5M

About

From the company's SBA profile, updated Mar 2026

Proteios incorporates proprietary protein technology into protein purification kits to allow Life Science researchers to quickly and easily purify proteins manufactured through recombinant technology. A short polypeptide is attached to the recombinant protein, which allows the protein to be captured on silica gel.

Prime contract obligations by fiscal year, US$, FY2021–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY21FY22FY23$2.05MFY25FY26$0 so far

Insight Largest year: $2.05M in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Washington$2.5M · 100%
Circle area = dollarsOutlined: head office state (Washington)

Insight 100% was performed in Washington. See more on the Contracts tab