Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Redlattice IncorporatedReport or remove this logo

Redlattice Incorporated Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary QBCUM7E61D72· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6TT21· CHANTILLY, VA· Active registration until Feb 13, 2027· redlattice.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$3.97MMissile Defense Agency$500FA2518 USSF SPOC/SAIO$3.38M · Air Force officeFA8307 AFLCMC HNCK HNC CYBER &NTR$584K · Air Force officeMISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeRedlattice Incorporated$3.97M
Awards toSubcontracts toCircle area = dollars

Insight FA2518 USSF SPOC/SAIO is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2017–FY2026

$7.68M

Includes FY2026 so far: $500, still being reported

Subcontracts it received

$34.3M

from 4 primes

About

From the company's SBA profile

REDLattice delivers technology, and engineering services to support government clients. We have deep domain expertise in research, software engineering development, technology operations. REDLattice is a veteran-owned small business providing advanced services and solutions to our National Security customers. The REDLattice team has decades of experience developing CNO / CNE tools for multiple organizations within the IC and DoD. In addition, our team has been responsible for the design and implementation of multiple large data platforms used by customers in the IC. We use these experiences and lessons learned to design a modular extensible platform that takes advantage of today’s technologies. We have extensive experience in big data analytics, process automation, Vulnerability Research and Computer Netowork Operations.

Prime contract obligations by fiscal year, US$, FY2017–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY17$2.7MFY18FY19FY22FY23FY24FY25FY26$500 so far

Insight Largest year: $2.7M in FY2017; since FY2021, $1.65M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Colorado$3.38M · 85%
  2. Virginia$584K · 15%
  3. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 85% was performed in Colorado. See more on the Contracts tab