Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Reliant Technologies Inc.Report or remove this logo

Reliant Technologies Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary LBVNTSBBA6N5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6SQ21· HUNTSVILLE, AL· Active registration until Jun 8, 2027· www.igniteimpossible.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$1.21MNavy$500W6QK ACC-RSA (W58RGZ)$1.21M · Army officeNSWC DAHLGREN (N00178)$500 · Navy officeReliant Technologies Inc.$1.21M
Awards toSubcontracts toCircle area = dollars

Insight W6QK ACC-RSA (W58RGZ) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2021–FY2026

$1.21M

Subcontracts it received

$16.7M

from 4 primes

About

From the company's SBA profile, updated Jun 2026

Reliant has direct experience in systems engineering (model based systems engineering, requirements development, traceability and verification, models & simulations and systems analysis); software development (parallel processing/multi-threading, data science using Python, Keras and Pandas); machine learning/artificial intelligence (sequence forecasting/prediction, text analysis & semantic modeling, signature modeling & classification, anomaly detection & monitoring, image analysis & classification); data analytics (functional dashboards & common operating pictures); and program management (schedule analysis, earned value, probabilistic risk assessment and budget planning).

Prime contract obligations by fiscal year, US$, FY2021–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY21FY22FY23$600KFY24FY25$500

Insight Largest year: $600K in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$1.21M · 100%
Circle area = dollarsOutlined: head office state (Alabama)

Insight 100% was performed in Alabama. See more on the Contracts tab