Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Runemaster, LLC Federal Contracts

Correct this listing

Doing business as RUNEMASTER LLC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary KK2TGXZ254P5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6UZZ3· CROFTON, MD· Active registration until Jan 21, 2027· www.runemasterllc.com (opens in a new tab)

Overview

Buyers and offices that award Runemaster prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$500NSWC DAHLGREN (N00178)$500 · Navy officeRunemaster, LLC$500
Awards toSubcontracts toCircle area = dollars

Insight NSWC DAHLGREN (N00178) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2019–FY2026

$500

About

From the company's SBA profile, updated Jan 2026

RüneMaster LLC combines our Norwegian heritage with more than 40 years’ experience in DoD, Cryptologic, and Intelligence Programs. We specialize in aiding our customers to decipher the information and business secrets important to protecting the country, while protecting their secrets from being exploited by our adversaries. Our Core Capabilities include: • Systems Engineering and Technical Assistance • Architecture Artifact Development • System Integration, Testing, Training, and Deployment • SE Documentation • Requirements Gathering, Analysis, and Decomposition • Software Development • Acquisition, Business Process, Financial Management • Op/TechELINT, COMEXT, FIS, PROFORMA, CYBER RF • Cross-domain fusion and Object Based Intelligence Products • Common Intelligence/Operating Picture Development and Use • Full Curriculum and Concept Documentation Development • Pre-Employment and Hiring Support Services

Prime contract obligations by fiscal year, US$, FY2019–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY19$500FY24$0

Insight Largest year: $500 in FY2019; since FY2021, $0 in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$500 since award = $0 in FY2021–FY2026 + $500 before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$500 · 100%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 100% was performed in Maryland. See more on the Contracts tab