Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Sabel Systems Technology Solutions, LLCReport or remove this logo

Sabel Systems Technology Solutions, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary F65SGFW2TUC6· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 5Z2A6· BEAVERCREEK, OH· Active registration until Nov 17, 2026· www.sabelsystems.com (opens in a new tab)

Part of Sagewind Capital LLC (opens another page) (parent company) · One of 22 registrations

Overview

Buyers, this company and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsFederal AcquisitionService$463MNavy$28.9MAir Force$25.2M4 more$22.4MGSA FAS AAS REGION 5(47QFLA)$463M · Federal Acquisiti…COMMANDING OFFICER(M95494)$28.7M · Navy officeFA7014 AFDW PK$15.2M · Air Force office9 more offices$32.7MSabel Systems TechnologySolutions, LLC$539MSiemens Government Technologies Inc.$13.9MMckinsey & Company, Inc. WashingtonD.C.$13MForge Group, LLC$2.9MAppian Corporation$2.27MK2 Firm, LLC$2.24MJackpine Technologies Corporation$2.19M29 more$19.4M
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 48% of what it reported subcontracting. See more on the Teaming tab

12 buying officesAll 35 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2012–FY2026

$579M

Includes FY2026 so far: $92.5M, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$55.9M

35 subcontractors

Subcontracts it received

$13.2M

from 12 primes

About

From the company's SBA profile, updated Nov 2025

Sabel Systems is an 8a Woman-Owned, Small Disadvantaged Business (WOSDB) that delivers people, process, and technology solutions. Our consultants apply a unique blend of business and solutions expertise gained in the leading international consulting firms, manufactures, and government agencies. Our team members possess an average of 17 years of experience in related fields. Our services include Strategic Consulting, Work Force Development, Technology Solutions, Business Analytics, Data Center/Cloud Solutions, Supply Chain Management, Quality Assurance & Independent Verification/Validation. Our business domain experiences include: Financial Management & Budgeting, Logistics, Federal Acquisitions, Program Management, Human Resources, Systems Sustainment, Engineering, Research & Development and Product Test, Verification & Validation.

Prime contract obligations by fiscal year, US$, FY2012–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY12FY14FY16FY18FY20FY22FY24$102MFY26FY26 so far: $92.5M

Insight Largest year: $102M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$539M since award = $484M in FY2021–FY2026 + $55.3M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$209M · 39%
  2. Ohio$195M · 36%
  3. District of Columbia$39.2M · 7.3%
  4. Utah$38M · 7.0%
  5. Michigan$22.6M · 4.2%

11 smaller, $36.1M together.

Circle area = dollarsOutlined: head office state (Ohio)

Insight 39% was performed in Virginia. See more on the Contracts tab