Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Saildrone Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary DR4UE3MCD3K7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7EAH1· ALAMEDA, CA· Active registration until May 27, 2027· www.saildrone.com (opens in a new tab)

Overview

Buyers and offices that award Saildrone prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyU.S. Coast Guard$36.7MNational Oceanic andAtmosphericAdministration$28.5MU.S. Geological Survey$1.09MHQ CONTRACT OPERATIONS (CG-912)(000(70Z023)$36.7M · U.S. Coast Guard officeDEPT OF COMMERCE NOAA (1305M2)$21.4M · National Oceanic and Atmosphe…DEPT OF COMMERCE NOAA (1305M3)$7.13M · National Oceanic and Atmosphe…1 more offices$1.09MSaildrone Inc.$66.3M
Awards toSubcontracts toCircle area = dollars

Insight HQ CONTRACT OPERATIONS (CG-912)(000 (70Z023) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2015–FY2026

$72.1M

Includes FY2026 so far: $32.5M, still being reported

Subcontracts it received

$4.33M

from 1 prime

About

From the company's SBA profile, updated May 2026

1. SAILDRONE INC. is a full-service, ocean and atmospheric data service provider and operator of proprietary, innovative and cost-efficient unmanned, autonomous maritime surface vehicles (USVs or Saildrones). These USVs have an integrated suite of environmental and Maritime Domain Awareness (MDA) and Intelligence, Surveillance and Reconnaissance (ISR) sensors, for the specific purpose of collecting high-resolution atmospheric, surface and sub-surface ocean data and then generating respective data products for a variety of customers and missions. Saildrones are unmanned surface vehicles (USV) engineered for oceanographic research and offshore data collection and powered by wind and solar energy.

Prime contract obligations by fiscal year, US$, FY2015–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY15FY16FY17FY18FY19FY20FY21FY22FY23FY24FY25$10.5MFY26$32.5M so far

Insight Largest year: $10.5M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$66.3M since award = $65M in FY2021–FY2026 + $1.28M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$45.5M · 69%
  2. Florida$10.7M · 16%
  3. Washington$5.82M · 8.8%
  4. Maine$2.13M · 3.2%
  5. Michigan$1.09M · 1.7%

2 smaller, $1M together.

Circle area = dollarsOutlined: head office state (California)

Insight 69% was performed in California. See more on the Contracts tab