Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
SBH Sciences Inc.Report or remove this logo

SBH Sciences Inc. Federal Contracts

Correct this listing

Doing business as SBH SCIENCES INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FPZHYNX9NCE5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 555M3· NATICK, MA· Active registration until Mar 23, 2027· www.sbhsciences.com (opens in a new tab)

Overview

Buyers and offices that award SBH Sciences prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Institutes ofHealth$8,300NATIONAL INSTITUTES OF HEALTH NHGRI(75N92E)$8,300 · National Institutes of Health of…SBH Sciences Inc.$8,300
Awards toSubcontracts toCircle area = dollars

Insight NATIONAL INSTITUTES OF HEALTH NHGRI (75N92E) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2015–FY2026

$62.4K

About

From the company's SBA profile, updated Oct 2026

SBH Sciences, MA-Based is a preclinical contract research organization (CRO) founded in 1997, providing research services and biological products to biotechnology, pharmaceutical, and diagnostic companies. Core capabilities include cell-based bioassays, assay development and validation, biomarker analysis, bioanalytical testing, cytokine and chemokine functional assays, immunology, oncology research, and protein production. SBH offers more than 380 validated bioassays, custom assay development, potency and mechanism-of-action studies, immune function characterization, and biomarker testing across 11 platforms. Additional capabilities include mammalian and insect cell culture, recombinant protein production, analytical testing, and clinical sample analysis through a CLIA-certified / GLP laboratory. SBH supports early discovery through preclinical development, including research and medical countermeasure development for biodefense applications. We have assisted over 400 companies.

Prime contract obligations by fiscal year, US$, FY2015–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY15FY16$54.9KFY17FY18FY19FY20FY22−$8,300

Insight Largest year: $54.9K in FY2016; since FY2021, −$8,300 in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$8,300 since award = −$8,300 in FY2021–FY2026 + $16.6K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$8,300 · 100%
Circle area = dollarsOutlined: head office state (Massachusetts)

Insight 100% was performed in Maryland. See more on the Contracts tab