Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Secure Enterprise Engineering, LLC Federal Contracts

Correct this listing

Doing business as SECURE ENTERPRISE ENGINEERING

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary LMGFVMUM6DN4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 47TB8· ANNAPOLIS, MD· Active registration until Feb 27, 2027· www.secure-ee.com (opens in a new tab)

Part of Sixgen Inc. (opens another page) (parent company) · One of 3 registrations

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$17.8MFA8307 AFLCMC HNCK HNC CYBER &NTR$17.8M · Air Force officeFA8649 USAF SBIR STTR CNTRCTNGAFRL$50K · Air Force officeSecure Enterprise Engineering, LLC$17.8M
Awards toSubcontracts toCircle area = dollars

Insight FA8307 AFLCMC HNCK HNC CYBER & NTR is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2020–FY2026

$19.4M

About

From the company's SBA profile

SEE is a Woman-Owned Small Business with over 15 years’ experience in engineering many of the IC’s and DoD’s most critical Cyber Defense and Warfare methodologies, architectures, and systems. We are a leading advisor/innovator at the forefront of capabilities that have and continue to influence today’s cyberspace warfighting domain. Our core competencies include Cybersecurity System Engineering and Integration for defensive, offensive, and SIGINT systems; Software and Solution Development for national mission forces operations; Ansible Automation of IT environments; and Network Engineering.

Prime contract obligations by fiscal year, US$, FY2020–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY20FY21FY22FY23$6.85MFY24FY25$1.42M

Insight Largest year: $6.85M in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$16M · 90%
  2. Texas$1.8M · 10%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 90% was performed in Maryland. See more on the Contracts tab